Service

 
 

Panjab University Research Scholars

 
S.No.Enrollment DateResearch ScholarTitle of Research Supervisor
Co-Supervisor
Funding Agencies
Department of Sanskrit
1.  25/11/2016Babbu RamProf. Lakhvir Singh
2.  22/10/2016SharwanDr. Devi Singh
3.  22/09/2016Heera LalDr. Devi Singh
4.  22/09/2016Ramanand MishraDr. Devi Singh
5.  22/09/2016Prakash ChandProf. Lakhvir Singh
6.  22/09/2016Satyan SharmaProf. Lakhvir SinghJRF
7.  09/09/2016SandeepDr. Devi Singh
8.  08/08/2016Amit KumarDr. Devi Singh
9.  24/12/2015PratibhaProf. Shankarji Jha
10.  04/12/2015Priyanka KaliyaProf. Vikram KumarUGC
11.  04/12/2015Sanjay SharmaProf. Lakhvir Singh
12.  04/11/2015Pawan KumarProf. Lakhvir SinghUGC
13.  04/11/2015Naresh KumarProf. Lakhvir Singh
14.  06/10/2015Rajesh KumarProf. Virender Kumar AlankarUGC
15.  06/10/2015Anup KumarProf. Virender Kumar AlankarUGC
16.  12/09/2014Poonam RaniBHARATIYA DARSANIKA CINTANA MEM BUDDHI TATTVA KI SVAPRAKASATA EVAM PRATIPAKSA ; EKA VIVECANATMAKA ADHYAYANAProf. Shankarji JhaUGC
17.  11/02/2014Karan SharmaNATYASASTRIYA TATTVOM KE PARIPREKSYA MEM ANARGHARAGHAVA AURA PRASANNARAGHAVA NATAKOM KA TULANATMAKA ADHYAYANAProf. Vikram Kumar
18.  01/10/2013HitenderSVAMI-RAMABHADRACARYA-PRANITA SRIBHARGAHAVIYAM MAHAKAVYA KA SAMIKSATMAKA EVAM BRHATTRAYI SE TULANATMAKA ADHYAYANAProf. Shankarji Jha
19.  17/09/2013Sunil KumarHARIYANA PRADESA KI SANSKRTAMAHAKAVYALEKHANAPARAMPARA MEM SVAMINIGAMABODHATIRTHA-VIRACITA SRISANKARACARITAM: EKA ADHYAYANAProf. Shankarji Jha
20.  17/09/2013Amit SharmaSAMSKRTASAHITYE KALATATTVA-PARYALOCANAMProf. Shankarji Jha
21.  17/09/2013Chaman LalABHIRAJA-RAJENDRAMISRAPRANITA SANSKRTA KATHA-SAHITYA :EKA SAMIKSATMAKA ADHYAYANAProf. Virender Kumar Alankar
22.  15/12/2012Ramneek SharmaSRIMADBHAGAVATA MEM PREMA KE VIVIDHA PAKSA : EKA ADHYAYANAProf. Shankarji Jha
23.  24/05/2012SomduttSISUPALAVADHA : EKA VAIYAKARANIKA ADHYAYANA (AKHYATA EVAM KRT PADOM KE VISESA SANDARBHA MEMProf. Vikram Kumar---
24.  24/05/2012RakeshNITYANANDA SASTRI PRANITA SRIRAMACARITABDHIRATNAM MAHAKAVYA KA CITRAKAVYAYVA EVAM CHANDOVAIVIDHYA :- EKA ADHYAYANAProf. Shankarji Jha
25.  17/01/2012Piyush AggarwalPaninian Samasa: Recognition and Processing-A Rule based ApproachProf. Vikram Kumar & Dr. Girish Nath Jha---
26.  09/07/2011Chander ParkashVyasa-Bhasya Ke Sandarbha Mem Yogasutra: Eka Vivecanatmaka Adhyayana”Prof. Vikram Kumar---
27.  24/09/2009Pawan KumarNaisadhiyacarita Mahakavya Mem Kriyapadom Ka Prayoga: Eka AdhyayanaProf. Shankarji Jha---
 
 

Enquiry No(s): 1800-180-2065, +91 172 2534818, 2534866 (from 9:30 am to 1:00 pm & 2:30 pm to 5:00 pm on working days including Saturday)

© 1997- 2017 - Panjab University, Chandigarh, India. Developed by: Computer Centre, Panjab University  |   Disclaimer

certificates-affidavits.com iorgroup.orgabout.chandigarhcity.info banks.indianypages.in callcustomercare.com chandigarhcity.info chandigarhcityinfo.com directory.scrollweb.com domain.welcome4solutions.com emedivision.com forum.chandigarhcity.info freenetsolutions.com helpdeskpunjab.com indianypages.in ludhianaonline.info maxweb.co.in maxwebsolutions.ca mohalicity.info navinka.com nicetimepass.com nict.in onlinedelhi.info rasoi.chandigarhcity.info safetyinfo4u.com safetyinfo4u.info safetyinfo4u.net safetyinfo4u.org scrollweb.com seo.freenetsolutions.com solidtimepass.com technology.freenetsolutions.com thechandigarhcity.com tools.freenetsolutions.com tricityhelpline.com vegculinary.com websites.chandigarhcity.info welcome4solutions.com www.callcustomercare.com www.chandigarhcity.info www.chandigarhcityinfo.com www.emedivision.com www.freenetsolutions.com www.helpdeskpunjab.com www.indianypages.in www.ludhianaonline.info www.maxweb.co.in www.maxwebsolutions.ca www.mohalicity.info www.navinka.com www.nicetimepass.com www.nict.in www.onlinedelhi.info www.safetyinfo4u.com www.solidtimepass.com www.thechandigarhcity.com www.tricityhelpline.com www.vegculinary.com www.welcome4solutions.com scrollyellowpages.com news.chandigarhcity.info FaceBook maxweb Twitter maxweb linkedin maxweb googleplus maxweb jobinfo.co.in indianhelpline.in