Service

 
 

Panjab University Research Scholars

 
S.No. Name of the Supervisor /
Co-Supervisor
Name of the Ph.D. Scholar Mode of Ph.D. Registration Number Date of Registration Research Topic Likely Date of Completion Availing Fellowship Funding Agency of Fellowship
Faculty of Languages : Department of SanskritUpdated on: 14/05/2018 
1.   Dr. Sushma Alankar Rakesh Kumar Full Time 17-18/421/Ph.D. 30/01/2018 No
2.   Dr. Sushma Alankar Rakesh Kumar Full Time 17-18/421/Ph.D. 30/01/2018 No
3.   Dr. R.K.Mahajan Kulbhushan Sharda Full Time 17-18/422/Ph.D. 30/01/2018 No
4.   Dr. Sushma Alankar Manish Sharma Full Time 17-18/479/Ph.D. 30/01/2018 No
5.   Dr. Sushma Alankar Manish Sharma Full Time 17-18/479/Ph.D. 30/01/2018 No
6.   Dr. R.K.Mahajan Pooja Full Time 17-18/484/Ph.D. 30/01/2018 No
7.   Dr. R.K.Mahajan Deepak Sharma Full Time 17-18/507/Ph.D. 30/01/2018 No
8.   Dr. R.K.Mahajan Mahabir Singh Full Time 17-18/506/Ph.D. 30/01/2018 No
9.   Prof. Lakhvir Singh Babbu Ram Full Time 16/323/Ph.D. 25/11/2016 KĀLIDĀSA EVAṀ BHAVABHŪTI KĪ NĀṬYASŪKTIYOṀ KĀ SAMĪKṢĀTMAKA ADHYAYANA No
10.   Prof. Lakhvir Singh Ruchi Rani Full Time 16/328/Ph.D. 25/11/2016 MAHABHARATA EVAṀ SANSKRIT KĀVYOṀ MEṀ BHĪṢMA-CARITA : EKA SAMĪKṢĀTMAKA ADHYAYANA No
11.   Dr. Devi Singh Sharwan Full Time 16/1170/Ph.D. 22/10/2016 SMĀRTTA PARAMPARĀ KE ĀLOKA MEṂ ŚUKRA EVAṂ VIDURA PROKTA ĀCĀRAMĪMĀṂSĀ : EKA ADHYAYANA No
12.   Prof. Shankarji Jha Heera Lal Full Time 16/270/Ph.D. 22/09/2016 CHAJJŪRĀMA ŚĀSTRĪ KṚTA ŚIVAKATHĀMṚTA MAHĀKĀVYA : EKA SAMĪKṢĀTMAKA ADHYAYANA No
13.   Dr. Devi Singh Ramanand Mishra Full Time 16/264/Ph.D. 22/09/2016 VĀLMĪKIRĀMĀYAṆA EVAṂ ADHYĀTMARĀMĀYAṆA MEṂ HANUMACCARITA : EKA TULANĀTMAKA ADHYAYANA No
14.   Prof. Lakhvir Singh Prakash Chand Full Time 16/266/Ph.D. 22/09/2016 PACATANTRA MEṀ NIHITA JĪVANAMŪLYA : EKA SAMĪKṢĀTMAKA ADHYAYANA No
15.   Prof. Lakhvir Singh Satyan Sharma Full Time 16/269/Ph.D. 22/09/2016 Yes UGC
16.   Dr. Devi Singh Sandeep Full Time 16/265/Ph.D. 09/09/2016 Yes UGC
17.   Dr. Devi Singh Amit Kumar Full Time 16/1169/Ph.D. 08/08/2016 BALABHADRAPRASĀDA ŚĀSTRĪ VIRACITA SINDHURĀJAVADHA MAHĀKĀVYA : EKA KĀVYAŚĀSTRĪYA PARIŚĪLANA No
18.   Prof. Shankarji Jha Pratibha Full Time 16/40/Ph.D. 24/12/2015 BHĀRATĪYA PRĀCĪNA EVAM ARVĀCĪNA PRACALITA ŚIKṢĀ PADDHATIYĀM : EKA TULANĀTMAKA ADHYAYANA No
19.   Prof. Vikram Kumar Priyanka Kaliya Full Time 15/367/Ph.d. 04/12/2015 SAMṢKṚTA NĀTYAŚĀSTRĪYA LAKṢAṆOṂ KE SANDARBHA MEṂ PRAMUKHA HINDĪ CALACITROṂ KĀ SAMĪKṢĀTMAKA ADHYAYANA No
20.   Prof. Lakhvir Singh Sanjay Sharma Full Time 15/1314/Ph.D. 04/12/2015 VĀLMĪKI RĀMĀYANA EVAṂ TADĀŚRITA PRAMUKHA KĀVYOṂ MEṂ GṚHASTHĀŚRAMA : EKA VIMARŚA No
21.   Prof. Lakhvir Singh Pawan Kumar Full Time 15/1278/Ph.D 04/11/2015 VARTAMĀNA PARIPREKṢYA MEṂ SMṚTIŚĀSTRĪYA NYĀYAVIDHI : EKA ADHYAYANA No
22.   Prof. Lakhvir Singh Naresh Kumar Full Time 15/1279/Ph.D 04/11/2015 RĀJANAITIKA PARIPREKṢYA MEṀ ŚUKRANĪTI TATHĀ KĀMANDAKĪYANĪTISĀRA KĀ TULANĀTMAKA ADHYAYANA No
23.   Prof. Virender Kumar Alankar
----
Rajesh Kumar Full Time 15/304/Ph.D. 06/10/2015 SAṂSKṚTA VĀNMAYA MEṂ ARJUNA-CARITA : EKA SAMĪKṢĀTMAKA ADHYAYANA No
24.   Prof. Virender Kumar Alankar Anup Kumar Full Time 15/305/Ph.D. 06/10/2015 ŚAIVAPURĀṆAGATA BHŪGOLA : EKA AITIHĀSIKA ADHYAYANA No
25.   Prof. V.K. Alankar VED PARKASH Full Time 14/378/Ph.D. 11/12/2014 VALMIKIRAMAYANOKTA VAMSA : EKA ADHYAYANA No
26.   Prof. Shankarji Jha Poonam Rani Full Time 14/207/Ph.D. 12/09/2014 BHARATIYA DARSANIKA CINTANA MEM BUDDHI TATTVA KI SVAPRAKASATA EVAM PRATIPAKSA ; EKA VIVECANATMAKA ADHYAYANA Yes UGC
27.   Prof. Vikram Kumar Karan Sharma Full Time 14/30/Ph.D. 11/02/2014 NATYASASTRIYA TATTVOM KE PARIPREKSYA MEM ANARGHARAGHAVA AURA PRASANNARAGHAVA NATAKOM KA TULANATMAKA ADHYAYANA No
28.   Prof. Shankarji Jha Hitender Full Time 13/1180/Ph.D. 01/10/2013 SVAMI-RAMABHADRACARYA-PRANITA SRIBHARGAHAVIYAM MAHAKAVYA KA SAMIKSATMAKA EVAM BRHATTRAYI SE TULANATMAKA ADHYAYANA No
29.   Prof. Shankarji Jha Sunil Kumar Full Time 13/1182/Ph.D. 17/09/2013 HARIYANA PRADESA KI SANSKRTAMAHAKAVYALEKHANAPARAMPARA MEM SVAMINIGAMABODHATIRTHA-VIRACITA SRISANKARACARITAM: EKA ADHYAYANA No
30.   Prof. Shankarji Jha Amit Sharma Full Time 13/1183/ Ph.D. 17/09/2013 SAMSKRTASAHITYE KALATATTVA-PARYALOCANAM No
31.   Prof. Virender Kumar Alankar Chaman Lal Full Time 13/1131/Ph.D 17/09/2013 ABHIRAJA-RAJENDRAMISRAPRANITA SANSKRTA KATHA-SAHITYA :EKA SAMIKSATMAKA ADHYAYANA No
32.   Prof. Shankarji Jha Ramneek Sharma Full Time 19262/Ph.D. 15/12/2012 SRIMADBHAGAVATA MEM PREMA KE VIVIDHA PAKSA : EKA ADHYAYANA No
33.   Prof. Vikram Kumar Somdutt Full Time 19172 24/05/2012 SISUPALAVADHA : EKA VAIYAKARANIKA ADHYAYANA (AKHYATA EVAM KRT PADOM KE VISESA SANDARBHA MEM No
 
 

Enquiry No(s): 1800-180-2065, +91 172 2534818, 2534866 (from 9:30 am to 1:00 pm & 2:30 pm to 5:00 pm on working days including Saturday)

© 1997- 2019 - Panjab University, Chandigarh, India. Developed by: Computer Centre, Panjab University  |   Disclaimer

www.questport.com w2s.co.inw2s.co.inguide.safetyinfo4u.comcertificates-affidavits.com iorgroup.orgabout.chandigarhcity.info banks.indianypages.in callcustomercare.com chandigarhcity.info chandigarhcityinfo.com directory.scrollweb.com domain.welcome4solutions.com emedivision.com forum.chandigarhcity.info freenetsolutions.com helpdeskpunjab.com indianypages.in ludhianaonline.info maxweb.co.in maxwebsolutions.ca mohalicity.info navinka.com nicetimepass.com nict.in onlinedelhi.info rasoi.chandigarhcity.info safetyinfo4u.com safetyinfo4u.info safetyinfo4u.net safetyinfo4u.org scrollweb.com seo.freenetsolutions.com solidtimepass.com technology.freenetsolutions.com thechandigarhcity.com tools.freenetsolutions.com tricityhelpline.com vegculinary.com websites.chandigarhcity.info welcome4solutions.com www.callcustomercare.com www.chandigarhcity.info www.chandigarhcityinfo.com www.emedivision.com www.freenetsolutions.com www.helpdeskpunjab.com www.indianypages.in www.ludhianaonline.info www.maxweb.co.in www.maxwebsolutions.ca www.mohalicity.info www.navinka.com www.nicetimepass.com www.nict.in www.onlinedelhi.info www.safetyinfo4u.com www.solidtimepass.com www.thechandigarhcity.com www.tricityhelpline.com www.vegculinary.com www.welcome4solutions.com scrollyellowpages.com news.chandigarhcity.info FaceBook maxweb Twitter maxweb linkedin maxweb googleplus maxweb jobinfo.co.in indianhelpline.in