Service

 
 

Panjab University Research Scholars

 
S.No. Name of the Supervisor /
Co-Supervisor
Name of the Ph.D. Scholar Mode of Ph.D. Registration Number Date of Registration Research Topic Likely Date of Completion Availing Fellowship Funding Agency of Fellowship
Faculty of Languages : Department of SanskritUpdated on: 19/01/2017 
1.   Prof. Lakhvir Singh Babbu Ram Full Time 16/323/Ph.D. 25/11/2016 No
2.   Dr. Devi Singh Sharwan Full Time 16/1170/Ph.D. 22/10/2016 No
3.   Dr. Devi Singh Heera Lal Full Time 16/270/Ph.D. 22/09/2016 No
4.   Dr. Devi Singh Ramanand Mishra Full Time 16/264/Ph.D. 22/09/2016 No
5.   Prof. Lakhvir Singh Prakash Chand Full Time 16/266/Ph.D. 22/09/2016 No
6.   Prof. Lakhvir Singh Satyan Sharma Full Time 16/269/Ph.D. 22/09/2016 Yes UGC
7.   Dr. Devi Singh Sandeep Full Time 16/265/Ph.D. 09/09/2016 Yes UGC
8.   Dr. Devi Singh Amit Kumar Full Time 16/1169/Ph.D. 08/08/2016 No
9.   Prof. Shankarji Jha Pratibha Full Time 16/40 24/12/2015 BHARTIYA PRACINA EVAM ARVACINA PRACALITA SIKSA PADDHATIYAM: eKA TULNATMAKA ADHYAYANA No
10.   Prof. Vikram Kumar Priyanka Kaliya Full Time 15/367/Ph.d. 04/12/2015 SAMSKRTA NATYASASTRIYA LAKSANOM KE SANDARBHA MEM PRAMUKHA HINDI CALACITROM KA SAMIKSATMAKA ADHYAYANA Yes UGC
11.   Prof. Lakhvir Singh Sanjay Sharma Full Time 15/1314/Ph.D. 04/12/2015 VALMIKI RAMAYANA EVAM TADASTRITA PRAMUKHA KAVYOM MEM GRHASTHASRAMA : EKA VIMARSA No
12.   Prof. Lakhvir Singh Pawan Kumar Full Time 15/1278/Ph.D 04/11/2015 VARTAMANA PARIPREKSYA MEM SMRITISASTRIYA NYAYAVIDHI : EKA ADHYAYANA Yes UGC
13.   Prof. Lakhvir Singh Naresh Kumar Full Time 15/1279/Ph.D 04/11/2015 RAJANAITIKA PARIPREKSYA MEM SUKRANITI TATHA KAMANDALIYANITISARA KA TULANATMAKA ADHYAYANA No
14.   Prof. Virender Kumar Alankar Rajesh Kumar Full Time 15/304/Ph.D. 06/10/2015 SAMSKRTA VANMAYA MEM ARJUNA CARITRA : EKA SAMIKSATMAKA ADHYAYANA Yes UGC
15.   Prof. Virender Kumar Alankar Anup Kumar Full Time 15/305/Ph.D. 06/10/2015 SAIVAPURANAGATA BHUGOLA : EKA AITIHASIKA ADHYAYANA Yes UGC
16.   Prof. Shankarji Jha Poonam Rani Full Time 14/207/Ph.D. 12/09/2014 BHARATIYA DARSANIKA CINTANA MEM BUDDHI TATTVA KI SVAPRAKASATA EVAM PRATIPAKSA ; EKA VIVECANATMAKA ADHYAYANA Yes UGC
17.   Prof. Vikram Kumar Karan Sharma Full Time 14/30/Ph.D. 11/02/2014 NATYASASTRIYA TATTVOM KE PARIPREKSYA MEM ANARGHARAGHAVA AURA PRASANNARAGHAVA NATAKOM KA TULANATMAKA ADHYAYANA No
18.   Prof. Shankarji Jha Hitender Full Time 13/1180/Ph.D. 01/10/2013 SVAMI-RAMABHADRACARYA-PRANITA SRIBHARGAHAVIYAM MAHAKAVYA KA SAMIKSATMAKA EVAM BRHATTRAYI SE TULANATMAKA ADHYAYANA No
19.   Prof. Shankarji Jha Sunil Kumar Full Time 13/1182/Ph.D. 17/09/2013 HARIYANA PRADESA KI SANSKRTAMAHAKAVYALEKHANAPARAMPARA MEM SVAMINIGAMABODHATIRTHA-VIRACITA SRISANKARACARITAM: EKA ADHYAYANA No
20.   Prof. Shankarji Jha Amit Sharma Full Time 13/1183/ Ph.D. 17/09/2013 SAMSKRTASAHITYE KALATATTVA-PARYALOCANAM No
21.   Prof. Virender Kumar Alankar Chaman Lal Full Time 13/1131/Ph.D 17/09/2013 ABHIRAJA-RAJENDRAMISRAPRANITA SANSKRTA KATHA-SAHITYA :EKA SAMIKSATMAKA ADHYAYANA No
22.   Prof. Shankarji Jha Ramneek Sharma Full Time 19262/Ph.D. 15/12/2012 SRIMADBHAGAVATA MEM PREMA KE VIVIDHA PAKSA : EKA ADHYAYANA No
23.   Prof. Vikram Kumar Somdutt Full Time 19172 24/05/2012 SISUPALAVADHA : EKA VAIYAKARANIKA ADHYAYANA (AKHYATA EVAM KRT PADOM KE VISESA SANDARBHA MEM No
24.   Prof. Shankarji Jha Rakesh Full Time 19176 24/05/2012 NITYANANDA SASTRI PRANITA SRIRAMACARITABDHIRATNAM MAHAKAVYA KA CITRAKAVYAYVA EVAM CHANDOVAIVIDHYA :- EKA ADHYAYANA No
25.   Prof. Vikram Kumar & Dr. Girish Nath Jha Piyush Aggarwal Full Time 18542 17/01/2012 Paninian Samasa: Recognition and Processing-A Rule based Approach No
26.   Prof. Vikram Kumar Chander Parkash Full Time 18036 09/07/2011 Vyasa-Bhasya Ke Sandarbha Mem Yogasutra: Eka Vivecanatmaka Adhyayana” No
27.   Prof. Shankarji Jha Pawan Kumar Full Time 17656 24/09/2009 Naisadhiyacarita Mahakavya Mem Kriyapadom Ka Prayoga: Eka Adhyayana No
 
 

Enquiry No(s): 1800-180-2065, +91 172 2534818, 2534866 (from 9:30 am to 1:00 pm & 2:30 pm to 5:00 pm on working days including Saturday)

© 1997- 2017 - Panjab University, Chandigarh, India. Developed by: Computer Centre, Panjab University  |   Disclaimer

certificates-affidavits.com iorgroup.orgabout.chandigarhcity.info banks.indianypages.in callcustomercare.com chandigarhcity.info chandigarhcityinfo.com directory.scrollweb.com domain.welcome4solutions.com emedivision.com forum.chandigarhcity.info freenetsolutions.com helpdeskpunjab.com indianypages.in ludhianaonline.info maxweb.co.in maxwebsolutions.ca mohalicity.info navinka.com nicetimepass.com nict.in onlinedelhi.info rasoi.chandigarhcity.info safetyinfo4u.com safetyinfo4u.info safetyinfo4u.net safetyinfo4u.org scrollweb.com seo.freenetsolutions.com solidtimepass.com technology.freenetsolutions.com thechandigarhcity.com tools.freenetsolutions.com tricityhelpline.com vegculinary.com websites.chandigarhcity.info welcome4solutions.com www.callcustomercare.com www.chandigarhcity.info www.chandigarhcityinfo.com www.emedivision.com www.freenetsolutions.com www.helpdeskpunjab.com www.indianypages.in www.ludhianaonline.info www.maxweb.co.in www.maxwebsolutions.ca www.mohalicity.info www.navinka.com www.nicetimepass.com www.nict.in www.onlinedelhi.info www.safetyinfo4u.com www.solidtimepass.com www.thechandigarhcity.com www.tricityhelpline.com www.vegculinary.com www.welcome4solutions.com scrollyellowpages.com news.chandigarhcity.info FaceBook maxweb Twitter maxweb linkedin maxweb googleplus maxweb jobinfo.co.in indianhelpline.in